RetrogeneDB ID: | retro_mmus_2289 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 3:108451267..108451527(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Cyb5b | ||
| Ensembl ID: | ENSMUSG00000031924 | ||
| Aliases: | Cyb5b, 1810044O22Rik, AU015618, Cyb5m | ||
| Description: | cytochrome b5 type B [Source:MGI Symbol;Acc:MGI:1913677] |
| Percent Identity: | 72.73 % |
| Parental protein coverage: | 59.59 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | EVLLEQAGADATESFEDVGHSPDAREMLKQYYIGDVHPSDLKPKGDDKDPSKNNS-CQSSWAYWFVPIVG |
| EVLLEQAG..A.ESFEDV.HS.DAREMLKQYYIGDVH.SDLKPKG..KDP......CQSSWAYW.V.IVG | |
| Retrocopy | EVLLEQAGTAAAESFEDVSHSRDAREMLKQYYIGDVHSSDLKPKGGNKDPLESKN<CQSSWAYWIVLIVG |
| Parental | AILIGFLYRHFWADSKSS |
| .ILIGF...HF..DS..S | |
| Retrocopy | TILIGFPCHHFSTDSTYS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 151 .51 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 113 .16 RPM |
| SRP007412_heart | 0 .00 RPM | 78 .26 RPM |
| SRP007412_kidney | 0 .00 RPM | 410 .31 RPM |
| SRP007412_liver | 0 .00 RPM | 500 .24 RPM |
| SRP007412_testis | 0 .00 RPM | 59 .69 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anas platyrhynchos | ENSAPLG00000007518 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000014234 | 1 retrocopy | |
| Felis catus | ENSFCAG00000024541 | 1 retrocopy | |
| Gallus gallus | ENSGALG00000000660 | 1 retrocopy | |
| Meleagris gallopavo | ENSMGAG00000008619 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000006608 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000012039 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000024646 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000031924 | 1 retrocopy |
retro_mmus_2289 ,
|
| Oryctolagus cuniculus | ENSOCUG00000007729 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000015984 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000014200 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000011316 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000010016 | 1 retrocopy | |
| Drosophila melanogaster | FBgn0029854 | 1 retrocopy |