RetrogeneDB ID: | retro_mmus_2226 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 3:14384085..14384411(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Csrp1 | ||
| Ensembl ID: | ENSMUSG00000026421 | ||
| Aliases: | Csrp1, AA408841, AA959891, AW545626, CRP1, Csrp | ||
| Description: | cysteine and glycine-rich protein 1 [Source:MGI Symbol;Acc:MGI:88549] |
| Percent Identity: | 79.09 % |
| Parental protein coverage: | 56.48 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 1 |
| Parental | MPNW-GGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPK |
| MPNW.GG.KKC.VCQKTVYFAEEVQ.EGNSFHKSCFLCM.CKKNLDSTTVAVHG.E.Y.KSCY.KK..PK | |
| Retrocopy | MPNW<GGSKKCMVCQKTVYFAEEVQ*EGNSFHKSCFLCMICKKNLDSTTVAVHGKESYFKSCYSKK*EPK |
| Parental | GYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKF |
| ..G...G.GTLSTDK.E.LGIK..EAPG.RPTTNP.ASKF | |
| Retrocopy | N*GNRRGTGTLSTDKDECLGIKPQEAPGYRPTTNPEASKF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 168 .77 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 176 .12 RPM |
| SRP007412_heart | 0 .00 RPM | 51 .49 RPM |
| SRP007412_kidney | 0 .00 RPM | 73 .78 RPM |
| SRP007412_liver | 0 .00 RPM | 15 .98 RPM |
| SRP007412_testis | 0 .00 RPM | 18 .62 RPM |
| TSS No. | TSS Name | TSS expression level (Expr) in TPM range: | ||||
|---|---|---|---|---|---|---|
| no expression | 0 < Expr ≤ 1 | 1 < Expr ≤ 5 | 5 < Expr ≤ 10 | Expr > 10 | ||
| TSS #1 | TSS_93071 | 172 libraries | 179 libraries | 638 libraries | 78 libraries | 5 libraries |

| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000012114 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000017067 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000020772 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000026421 | 1 retrocopy |
retro_mmus_2226 ,
|
| Pan troglodytes | ENSPTRG00000001836 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000008991 | 1 retrocopy | |
| Drosophila melanogaster | FBgn0259209 | 1 retrocopy |