RetrogeneDB ID: | retro_mmus_1774 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 18:46465367..46465790(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSMUSG00000046487 | |
| Aliases: | Mospd4, 2010013H21Rik | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Vapa | ||
| Ensembl ID: | ENSMUSG00000024091 | ||
| Aliases: | Vapa, 33kDa, VAP33 | ||
| Description: | vesicle-associated membrane protein, associated protein A [Source:MGI Symbol;Acc:MGI:1353561] |
| Percent Identity: | 70.21 % |
| Parental protein coverage: | 56.63 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MASASGAMAKHEQILVLDPPSDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPRRYCVRPNSGIIDP |
| MAS.S.A.AK..Q.LVLDPP.DLKFKGPFT...T..LKL.NPS.RKVCFKVK.T.PRRYCVRPN.G.IDP | |
| Retrocopy | MASTSRAPAKPQQVLVLDPPTDLKFKGPFTGLLTAHLKLRNPSARKVCFKVKSTSPRRYCVRPNNGVIDP |
| Parental | GSIVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNISDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLN |
| G..VTV....QP....P....KHKFMVQT.FAPP.ISD.EAVW.EA.P.ELMDSKLRCVFE.P.E.DKL. | |
| Retrocopy | GCTVTVAATMQPSCCGPSKEVKHKFMVQTVFAPPDISDLEAVWREAHPGELMDSKLRCVFEPPTESDKLE |
| Parental | D |
| D | |
| Retrocopy | D |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .02 RPM | 94 .46 RPM |
| SRP007412_cerebellum | 0 .13 RPM | 65 .13 RPM |
| SRP007412_heart | 0 .03 RPM | 36 .45 RPM |
| SRP007412_kidney | 0 .06 RPM | 51 .94 RPM |
| SRP007412_liver | 0 .03 RPM | 47 .90 RPM |
| SRP007412_testis | 56 .30 RPM | 59 .92 RPM |
| TSS No. | TSS Name | TSS expression level (Expr) in TPM range: | ||||
|---|---|---|---|---|---|---|
| no expression | 0 < Expr ≤ 1 | 1 < Expr ≤ 5 | 5 < Expr ≤ 10 | Expr > 10 | ||
| TSS #1 | TSS_59542 | 1039 libraries | 26 libraries | 1 library | 2 libraries | 4 libraries |

| Species | RetrogeneDB ID |
|---|---|
| Rattus norvegicus | retro_rnor_266 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Cavia porcellus | ENSCPOG00000006042 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000008965 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000021442 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000024091 | 1 retrocopy |
retro_mmus_1774 ,
|
| Rattus norvegicus | ENSRNOG00000014765 | 1 retrocopy |