RetrogeneDB ID: | retro_mmus_1309 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 14:106211776..106212023(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | Sec61g | ||
| Ensembl ID: | ENSMUSG00000078974 | ||
| Aliases: | None | ||
| Description: | SEC61, gamma subunit [Source:MGI Symbol;Acc:MGI:1202066] |
| Percent Identity: | 72.29 % |
| Parental protein coverage: | 82. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | PELRVSTLSIRHPTNMDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFA-IMGFIGFFV |
| P.L.VS..S..HP..MDQV.QFVE.SRQF.K.SI.LVKRCTK..RKEFQKIA.ATAIG.A..MGFIGFFV | |
| Retrocopy | PMLCVSIFSKCHPIDMDQVIQFVELSRQFSKNSIHLVKRCTKIHRKEFQKIAKATAIGPA>LMGFIGFFV |
| Parental | KLIHIPINNIIVG |
| KLIHIPI.N...G | |
| Retrocopy | KLIHIPIHNTVAG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 4 .09 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 3 .43 RPM |
| SRP007412_heart | 0 .00 RPM | 1 .28 RPM |
| SRP007412_kidney | 0 .00 RPM | 1 .23 RPM |
| SRP007412_liver | 0 .00 RPM | 1 .47 RPM |
| SRP007412_testis | 0 .09 RPM | 1 .78 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Mus musculus | ENSMUSG00000078974 | 13 retrocopies | |
| Tarsius syrichta | ENSTSYG00000014302 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000000593 | 1 retrocopy |