RetrogeneDB ID: | retro_mmul_820 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 11:71558240..71558450(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMMUG00000029935 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 72.86 % |
| Parental protein coverage: | 65.42 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | MEEMSLSGLDNSKLEAIAQEIYADLVEDSCLGFCFEVHRAVKCGYFFLDDTDPDSMKDFGFQPVEEQGVC |
| MEE.SL..LD..KLEAIAQEIY.DL.EDSCLGFCFEVHRAVKCGYF.L......S.KDFG.QPVE..G.C | |
| Retrocopy | MEEISLANLDTNKLEAIAQEIYVDLIEDSCLGFCFEVHRAVKCGYFYLEFAETGSVKDFGIQPVEDKGAC |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 14 .34 RPM | 23 .64 RPM |
| SRP007412_brain_prefrontal_cortex | 21 .02 RPM | 27 .05 RPM |
| SRP007412_cerebellum | 11 .62 RPM | 11 .17 RPM |
| SRP007412_heart | 4 .59 RPM | 4 .06 RPM |
| SRP007412_kidney | 4 .46 RPM | 3 .40 RPM |
| SRP007412_liver | 1 .62 RPM | 2 .85 RPM |
| SRP007412_testis | 3 .02 RPM | 20 .09 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000003379 | 13 retrocopies | |
| Homo sapiens | ENSG00000087152 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000010959 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000006416 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000029935 | 1 retrocopy |
retro_mmul_820 ,
|