RetrogeneDB ID: | retro_mmul_660 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 1099214009890:227..452(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MMU.514 | ||
| Ensembl ID: | ENSMMUG00000013221 | ||
| Aliases: | None | ||
| Description: | dynein light chain Tctex-type 3 [Source:RefSeq peptide;Acc:NP_001253456] |
| Percent Identity: | 85.33 % |
| Parental protein coverage: | 64.66 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | QWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFA |
| Q...SIVEQSLTHLVKLGKA.KYIVTCAVVQKS..GF.TASSCFW.TTSDGTCT.RWEN.TMNCIVN.FA | |
| Retrocopy | QYQPSIVEQSLTHLVKLGKACKYIVTCAVVQKSTHGFQTASSCFWNTTSDGTCTIRWENQTMNCIVNIFA |
| Parental | IAIVL |
| IAIVL | |
| Retrocopy | IAIVL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 41 .68 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 26 .02 RPM |
| SRP007412_cerebellum | 0 .06 RPM | 22 .67 RPM |
| SRP007412_heart | 0 .00 RPM | 5 .01 RPM |
| SRP007412_kidney | 0 .00 RPM | 9 .04 RPM |
| SRP007412_liver | 0 .00 RPM | 3 .17 RPM |
| SRP007412_testis | 0 .00 RPM | 11 .76 RPM |