RetrogeneDB ID: | retro_mmul_549 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 1:165283170..165283474(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MMU.1735 | ||
| Ensembl ID: | ENSMMUG00000017370 | ||
| Aliases: | None | ||
| Description: | signal peptidase complex subunit 1 [Source:RefSeq peptide;Acc:NP_001180678] |
| Percent Identity: | 72.12 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 2 |
| Parental | MLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSCLLTLPPWPIY |
| MLEH.S.LP...DYKGQKL.EQMFQ.II.FS..VGFIYGYVAE....TVYIV.AGFAFS.LLTL.PWPI. | |
| Retrocopy | MLEHMSLLPI*IDYKGQKLVEQMFQRIITFSSVVGFIYGYVAEHCR*TVYIVIAGFAFSHLLTLHPWPIH |
| Parental | RRHPLKWLPVQDSS-TDDKK-PGERKIKRHAKNN |
| ..HPLK.L.VQDSS.T...K..G.RKIKRHAKNN | |
| Retrocopy | HWHPLKRLHVQDSS<TENEK<AGDRKIKRHAKNN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 29 .81 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 26 .97 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 26 .93 RPM |
| SRP007412_heart | 0 .00 RPM | 38 .69 RPM |
| SRP007412_kidney | 0 .00 RPM | 51 .64 RPM |
| SRP007412_liver | 0 .00 RPM | 62 .07 RPM |
| SRP007412_testis | 0 .00 RPM | 187 .07 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_294 |
| Pan troglodytes | retro_ptro_241 |
| Gorilla gorilla | retro_ggor_332 |
| Pongo abelii | retro_pabe_380 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000008426 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000008927 | 1 retrocopy | |
| Equus caballus | ENSECAG00000023559 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000007914 | 1 retrocopy | |
| Homo sapiens | ENSG00000114902 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000028027 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000014061 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000000744 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000017370 | 1 retrocopy |
retro_mmul_549 ,
|
| Otolemur garnettii | ENSOGAG00000004106 | 3 retrocopies | |
| Pongo abelii | ENSPPYG00000013798 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000015011 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000006854 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000008576 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000007380 | 1 retrocopy |