RetrogeneDB ID: | retro_mmul_414 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 1:130935775..130936055(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSMMUG00000009039 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | HMGN3 | ||
| Ensembl ID: | ENSMMUG00000004351 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 78.95 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | SPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGK-KEEKQEAGKEG |
| S.ENTEG.DGSKVTKQEPTR.S.R.S.KP.PPKP.PK.RKTSA.KEPGAK.SRGAKGK.KE....AGKEG | |
| Retrocopy | SSENTEGEDGSKVTKQEPTRWSPRWSVKPPPPKPAPKQRKTSAEKEPGAKVSRGAKGK>KEKQE-AGKEG |
| Parental | TAPSENGETKAEEAQKTESVDNEGE |
| TAPSEN..TKAEEAQKTESV.N.GE | |
| Retrocopy | TAPSENDKTKAEEAQKTESVVNQGE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 25 .44 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 12 .61 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 29 .70 RPM |
| SRP007412_heart | 0 .00 RPM | 67 .84 RPM |
| SRP007412_kidney | 0 .00 RPM | 36 .50 RPM |
| SRP007412_liver | 0 .00 RPM | 7 .52 RPM |
| SRP007412_testis | 0 .00 RPM | 6 .71 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_231 |
| Pan troglodytes | retro_ptro_200 |
| Pongo abelii | retro_pabe_421 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000007015 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000012407 | 2 retrocopies | |
| Felis catus | ENSFCAG00000028793 | 1 retrocopy | |
| Homo sapiens | ENSG00000118418 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000006910 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000004351 | 1 retrocopy |
retro_mmul_414 ,
|
| Nomascus leucogenys | ENSNLEG00000012377 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000016487 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000009611 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000018366 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000014353 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000015468 | 3 retrocopies | |
| Tarsius syrichta | ENSTSYG00000005238 | 3 retrocopies |