RetrogeneDB ID: | retro_mmul_2280 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 8:18896844..18897187(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MMU.18828 | ||
| Ensembl ID: | ENSMMUG00000022419 | ||
| Aliases: | C8H8orf46, C8orf46 | ||
| Description: | chromosome 8 open reading frame 46 [Source:RefSeq peptide;Acc:NP_001181830] |
| Percent Identity: | 60.34 % |
| Parental protein coverage: | 55.34 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | VGISEPKTSNLCG-NRAYGK-SLIPPVPRISVKTPTSASLEATVMGTEKGAVLMRGSRHLKKMTEEYPAL |
| V.ISEPK.SNL...NRA.GK.SL..PV.RIS.K.P.SA..EA...G.EK....M.G.R.L..MT.EY... | |
| Retrocopy | VEISEPKASNLYRKNRAHGK>SLTAPVSRISMKAPASALVEAAALGSEKEGIQMTGFRPLR-MTKEYLSI |
| Parental | PQGVEASLPLTGSASCGVPGILRKMWTRHKKKSEYVGATNSAFEAD |
| .QG.EASL.LTGS.SCGVP...RK.WTRHKK..EYV.AT..AF.AD | |
| Retrocopy | HQGAEASLSLTGSTSCGVPSSPRKLWTRHKKTPEYVRATDTAFQAD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 157 .54 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 185 .47 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 9 .75 RPM |
| SRP007412_heart | 0 .06 RPM | 10 .30 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .35 RPM |
| SRP007412_liver | 0 .12 RPM | 0 .20 RPM |
| SRP007412_testis | 0 .04 RPM | 0 .23 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3937 |
| Pan troglodytes | retro_ptro_2673 |
| Gorilla gorilla | retro_ggor_2646 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Homo sapiens | ENSG00000169085 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000008516 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000022419 | 1 retrocopy |
retro_mmul_2280 ,
|
| Nomascus leucogenys | ENSNLEG00000010728 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000018639 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000020307 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000014906 | 1 retrocopy |