RetrogeneDB ID: | retro_mmul_2246 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 7:104590577..104590805(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MMU.9813 | ||
| Ensembl ID: | ENSMMUG00000020666 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 67.11 % |
| Parental protein coverage: | 54.68 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | HFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIA |
| HFP.D.PFKP..VA...RIY.PNINSN.SICL.ILR.Q.S.ALTI...LL.ICSL.C.PNPDD..VPEIA | |
| Retrocopy | HFPIDFPFKPHEVALRKRIYQPNINSNDSICLNILRLQSSSALTIFNILLFICSLPCNPNPDDF*VPEIA |
| Parental | RIYKTD |
| ...KT. | |
| Retrocopy | GNNKTE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 17 .37 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 18 .01 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 14 .98 RPM |
| SRP007412_heart | 0 .00 RPM | 11 .01 RPM |
| SRP007412_kidney | 0 .00 RPM | 11 .15 RPM |
| SRP007412_liver | 0 .00 RPM | 7 .80 RPM |
| SRP007412_testis | 0 .00 RPM | 49 .98 RPM |