RetrogeneDB ID: | retro_mmul_2195 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 7:140851356..140851758(+) | ||
| Located in intron of: | ENSMMUG00000023626 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MMU.19036 | ||
| Ensembl ID: | ENSMMUG00000019610 | ||
| Aliases: | None | ||
| Description: | zinc finger MYND domain-containing protein 19 [Source:RefSeq peptide;Acc:NP_001181660] |
| Percent Identity: | 63.77 % |
| Parental protein coverage: | 59.91 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected | 2 |
| Parental | TLIDEQ-DIPLVESYSFEARMEVDADGNGAKIFAYAFDKNRGRGSGRLLHELLWERHRGGVAPGFQVVHL |
| TL.D.Q.DI.LVE.YS.EA.MEVDADGNG.KIF..AFDK..GRG.GRLLHELLW..HR....PG.QVVHL | |
| Retrocopy | TLTDAQ>DILLVERYSSEAQMEVDADGNGSKIFRNAFDKH*GRGLGRLLHELLW-*HRSSMTPGIQVVHL |
| Parental | NAVTVDNRLDNLQLVPWGWRPKAEETSSKQREQSLYWLAIQQLP-TDPIEEQFPVLNVTRYYNANGDV |
| NA.T.DN..DNL.LV.WGW..KA.ET.S.........L....LP..DP.EEQ.PVL.VT.YYN.NGDV | |
| Retrocopy | NALTEDNYPDNL*LVLWGWWSKAKET-SRRESKACTGLQFSSLP<MDPKEEQ*PVLTVTWYYNTNGDV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 6 .72 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .08 RPM | 13 .25 RPM |
| SRP007412_cerebellum | 0 .06 RPM | 3 .87 RPM |
| SRP007412_heart | 0 .00 RPM | 3 .18 RPM |
| SRP007412_kidney | 0 .00 RPM | 3 .76 RPM |
| SRP007412_liver | 0 .04 RPM | 2 .38 RPM |
| SRP007412_testis | 0 .00 RPM | 20 .02 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1367 |
| Gorilla gorilla | retro_ggor_1065 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000006644 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000008360 | 1 retrocopy | |
| Equus caballus | ENSECAG00000012412 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000005023 | 1 retrocopy | |
| Homo sapiens | ENSG00000165724 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000006875 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000011727 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000019610 | 1 retrocopy |
retro_mmul_2195 ,
|
| Monodelphis domestica | ENSMODG00000017172 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000026974 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000009236 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000010812 | 1 retrocopy |