RetrogeneDB ID: | retro_mmul_1809 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 4:157086639..157087023(+) | ||
| Located in intron of: | ENSMMUG00000015658 | ||
Retrocopyinformation | Ensembl ID: | ENSMMUG00000029372 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | CHP | ||
| Ensembl ID: | ENSMMUG00000017092 | ||
| Aliases: | None | ||
| Description: | calcium-binding protein p22 [Source:RefSeq peptide;Acc:NP_001253300] |
| Percent Identity: | 85.16 % |
| Parental protein coverage: | 65.64 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | REDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHF |
| ..DFQ.IPELAINP.G..IINAFFPEGEDQVNFRGF..TLAHFR.I.DNEKSKDVNGPEPLNSRSNKLHF | |
| Retrocopy | QDDFQGIPELAINPVGNWIINAFFPEGEDQVNFRGFLQTLAHFRTIKDNEKSKDVNGPEPLNSRSNKLHF |
| Parental | AFRLYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTE |
| AFRLYDLDKD.KISRDELL.VL.MMV.V.ISDEQLGSIADRTIQEADQ.GDSAIS... | |
| Retrocopy | AFRLYDLDKDNKISRDELLKVLCMMVRVHISDEQLGSIADRTIQEADQRGDSAISLSQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .22 RPM | 54 .34 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .08 RPM | 61 .80 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 20 .53 RPM |
| SRP007412_heart | 0 .12 RPM | 23 .79 RPM |
| SRP007412_kidney | 0 .12 RPM | 30 .40 RPM |
| SRP007412_liver | 0 .04 RPM | 25 .53 RPM |
| SRP007412_testis | 0 .00 RPM | 19 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000009525 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000010577 | 2 retrocopies | |
| Homo sapiens | ENSG00000187446 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000007312 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000017092 | 2 retrocopies |
retro_mmul_1809 , retro_mmul_2088,
|
| Macaca mulatta | ENSMMUG00000017460 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000014077 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000003465 | 4 retrocopies | |
| Procavia capensis | ENSPCAG00000005419 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000006370 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000006942 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000004742 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000014503 | 1 retrocopy |