RetrogeneDB ID: | retro_meug_838 | ||
Retrocopylocation | Organism: | Wallaby (Macropus eugenii) | |
| Coordinates: | Scaffold20389:15828..16053(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSMEUG00000014652 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | RPP14 | ||
| Ensembl ID: | ENSMEUG00000010883 | ||
| Aliases: | None | ||
| Description: | ribonuclease P/MRP 14kDa subunit [Source:HGNC Symbol;Acc:30327] |
| Percent Identity: | 86.67 % |
| Parental protein coverage: | 60.48 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | PSEYHYMKVQLEFQDRGFRLTDAQFKQLIVLALKDLFGEVGAALPFDVLTYEEKTLSAILRICSRGLVKV |
| PSEYHYMKVQ.EFQ..GFRLTDAQFK.LI.LALKDLFGE.GA.LPFDVLT.EEKTLSAILRICS.GLVKV | |
| Retrocopy | PSEYHYMKVQFEFQNHGFRLTDAQFK*LIILALKDLFGEAGAVLPFDVLTCEEKTLSAILRICSSGLVKV |
| Parental | WSSLT |
| W.SLT | |
| Retrocopy | WNSLT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000019987 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000004281 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000013439 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000010883 | 1 retrocopy |
retro_meug_838 ,
|
| Microcebus murinus | ENSMICG00000014541 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000007998 | 1 retrocopy | |
| Ornithorhynchus anatinus | ENSOANG00000022513 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000027202 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000039829 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000015394 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000013343 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000000935 | 1 retrocopy |