RetrogeneDB ID: | retro_meug_64 | ||
Retrocopylocation | Organism: | Wallaby (Macropus eugenii) | |
| Coordinates: | GeneScaffold_1098:24753..24986(-) | ||
| Located in intron of: | ENSMEUG00000007528 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ERH | ||
| Ensembl ID: | ENSMEUG00000014602 | ||
| Aliases: | None | ||
| Description: | enhancer of rudimentary homolog (Drosophila) [Source:HGNC Symbol;Acc:3447] |
| Percent Identity: | 51.76 % |
| Parental protein coverage: | 81.55 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected | 1 |
| Parental | SHTILLVQPT-KRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCL |
| SH.ILL.Q.T...PEGR..A....VNECM..VCKMYEEHLK.....S..IT..I...FDFI.D....SCL | |
| Retrocopy | SHMILLAQQT<SLPEGRICANF*RVNECMKNVCKMYEEHLKITQHLS--ITFKIF*FFDFIED----SCL |
| Parental | VYRADTQTYQPYNKD |
| .Y...T.....Y.KD | |
| Retrocopy | IY*TITKID*LYLKD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000014529 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000014940 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000006912 | 3 retrocopies | |
| Equus caballus | ENSECAG00000019178 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000014602 | 3 retrocopies |
retro_meug_1469, retro_meug_498, retro_meug_64 ,
|
| Myotis lucifugus | ENSMLUG00000011879 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000021571 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000004636 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000029388 | 5 retrocopies | |
| Rattus norvegicus | ENSRNOG00000004883 | 3 retrocopies |