RetrogeneDB ID: | retro_meug_467 | ||
Retrocopylocation | Organism: | Wallaby (Macropus eugenii) | |
| Coordinates: | Scaffold11909:2695..2926(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NDUFA4L2 | ||
| Ensembl ID: | ENSMEUG00000014358 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4-like 2 [Source:HGNC Symbol;Acc:29836] |
| Percent Identity: | 54.55 % |
| Parental protein coverage: | 88.51 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | IRQIKKNPGLIPLISFIGLGMGSAALYLLRLALRSPDVSWDRKNNPEPWNRLSPNDQYKFLAVSMDYKKL |
| I.Q.KK...LI.L..FIG.G.....LY...LAL..PD.SW.RKNNPEPWN...P..Q.KF..V..DY.KL | |
| Retrocopy | INQAKKH*SLILLFVFIGVGGTRVTLYVMCLALFNPDISWNRKNNPEPWNKMNPTNQNKFYSVNVDYSKL |
| Parental | KKDRPDF |
| KK..P.F | |
| Retrocopy | KKKGPGF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Echinops telfairi | ENSETEG00000004466 | 1 retrocopy | |
| Homo sapiens | ENSG00000185633 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000021950 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000014358 | 3 retrocopies |
retro_meug_1159, retro_meug_1559, retro_meug_467 ,
|
| Nomascus leucogenys | ENSNLEG00000017371 | 10 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000020476 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000015731 | 5 retrocopies |