RetrogeneDB ID: | retro_meug_454 | ||
Retrocopylocation | Organism: | Wallaby (Macropus eugenii) | |
| Coordinates: | Scaffold116947:905..1148(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | COA3 | ||
| Ensembl ID: | ENSMEUG00000011666 | ||
| Aliases: | None | ||
| Description: | cytochrome c oxidase assembly factor 3 [Source:HGNC Symbol;Acc:24990] |
| Percent Identity: | 53.09 % |
| Parental protein coverage: | 81. % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | KAPVAQRIDPAREKLSPAQLHFMRQVELSQWQKTLPQRRGRNIVTGLSIGALVLAIXXXXXXXXXXXXFL |
| K..VAQRID...EKLS.....FM.QVEL.QWQKTL.Q....NI....SI.AL.LAI............FL | |
| Retrocopy | KVQVAQRIDLKGEKLSST*TLFMWQVELCQWQKTLLQWGSQNILACMSIRALSLAIYGYALYSVKQ*RFL |
| Parental | DDLEDKAKAAR |
| DDLEDK.K..R | |
| Retrocopy | DDLEDKVKGTR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Macropus eugenii | ENSMEUG00000011666 | 2 retrocopies |
retro_meug_1671, retro_meug_454 ,
|