RetrogeneDB ID: | retro_meug_223 | ||
Retrocopylocation | Organism: | Wallaby (Macropus eugenii) | |
| Coordinates: | GeneScaffold_661:24972..25216(+) | ||
| Located in intron of: | ENSMEUG00000015849 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MPV17L2 | ||
| Ensembl ID: | ENSMEUG00000016379 | ||
| Aliases: | None | ||
| Description: | MPV17 mitochondrial membrane protein-like 2 [Source:HGNC Symbol;Acc:28177] |
| Percent Identity: | 81.71 % |
| Parental protein coverage: | 64.8 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | VASPVLGVWYFLGLGCLEGQSLDTSCQELQDKFWEFYKADWCVWPAAQLVNFLYVPTH-YRVMYVNSVTL |
| VA.P.LG..YFL.LGCLEGQSLDT.CQELQDK..EFYKADWCV.PAAQLVNFLYVPTH....MYVNSVTL | |
| Retrocopy | VATPILGR*YFLALGCLEGQSLDTTCQELQDKL*EFYKADWCVLPAAQLVNFLYVPTH>RACMYVNSVTL |
| Parental | GWDTYLSYLKHR |
| GWDTYLSY.KH. | |
| Retrocopy | GWDTYLSYTKHQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Anolis carolinensis | ENSACAG00000027644 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000025788 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000014104 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000013840 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000016379 | 2 retrocopies |
retro_meug_223 , retro_meug_943,
|
| Macaca mulatta | ENSMMUG00000005025 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000005944 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000002028 | 1 retrocopy |