RetrogeneDB ID: | retro_meug_1100 | ||
Retrocopylocation | Organism: | Wallaby (Macropus eugenii) | |
| Coordinates: | Scaffold288207:1312..1561(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMEUG00000004815 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 79.52 % |
| Parental protein coverage: | 71.55 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 0 |
| Parental | MVDINLVSLANLPKLPRLRKLELSDNHLSGGLEVLAERTPSLVQLNLSGNKIKDINTLEPLKKLPNLKSL |
| .V.I..VSLANLPKLPRL.KLELS.NHLS.GLEVL...TPSL.QLNLSGNKIKDINTLEPLKKL.N.KSL | |
| Retrocopy | IVNISFVSLANLPKLPRLQKLELSNNHLS*GLEVLV*QTPSLIQLNLSGNKIKDINTLEPLKKLLNFKSL |
| Parental | DLFKCDVTMLMSY |
| .LFKC.VTMLM.. | |
| Retrocopy | ELFKCKVTMLMNF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Macropus eugenii | ENSMEUG00000004815 | 3 retrocopies |
retro_meug_1100 , retro_meug_1714, retro_meug_497,
|