RetrogeneDB ID: | retro_mdom_940 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 2:516764956..516765114(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMODG00000007240 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 70.91 % |
| Parental protein coverage: | 78.26 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | CHSLRTTKSDFYIWSRFKFLPCLFFFFFLKQFS-KVLKGKSEFLWILLVPALRFF |
| C.SLRTTKSDFYIWS......C.......KQFS.KVLKGKSEFLWILLVPA.RFF | |
| Retrocopy | CQSLRTTKSDFYIWSQ-NLGSCPVXXXXXKQFS<KVLKGKSEFLWILLVPAFRFF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Monodelphis domestica | ENSMODG00000007240 | 2 retrocopies |
retro_mdom_421, retro_mdom_940 ,
|