RetrogeneDB ID: | retro_mdom_480 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 1:715628127..715628373(+) | ||
| Located in intron of: | ENSMODG00000009815 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMODG00000023045 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 71.95 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | CERPGPSLLTVIVPDVFWFHTADGKRVICPRATATEPGRDARLQVGSIVNEEPGRLAWGLLVPVYAGTNA |
| CER....L..VI..D..WFH..DGKR.ICPRATATEPGRD.RLQ.GS..NEEPGRLAWG.LVP....TNA | |
| Retrocopy | CERRAI*LQAVIESDILWFHSTDGKREICPRATATEPGRDPRLQAGSPINEEPGRLAWGMLVPAHVITNA |
| Parental | LTGPAGQGDRLS |
| LTG.AGQGDRLS | |
| Retrocopy | LTGSAGQGDRLS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Monodelphis domestica | ENSMODG00000023045 | 10 retrocopies |
retro_mdom_471, retro_mdom_472, retro_mdom_474, retro_mdom_478, retro_mdom_480 , retro_mdom_482, retro_mdom_484, retro_mdom_486, retro_mdom_657, retro_mdom_658,
|