RetrogeneDB ID: | retro_mdom_1785 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 7:94771356..94771632(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MRPS24 | ||
| Ensembl ID: | ENSMODG00000013889 | ||
| Aliases: | None | ||
| Description: | mitochondrial ribosomal protein S24 [Source:HGNC Symbol;Acc:14510] |
| Percent Identity: | 67.39 % |
| Parental protein coverage: | 55.09 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 0 |
| Parental | QLLSACRGVHTTAICCKNRAARVRVGKGDKPVTYEQAHPPHYIAHRKGWLSLHTSNLDGEEGASDRTVED |
| .LLSAC.GVH.T.IC.KN......VGK.DK.VT.E.A.PPHYIAHRKGWLSLH..NLDGE.GA.DR.V.D | |
| Retrocopy | ELLSACGGVHITEICLKNWSTQGQVGKADKLVT*E*AYPPHYIAHRKGWLSLHKTNLDGEQGATDRMVDD |
| Parental | VFIRKFLYGTFPGCLADQVVLK |
| VFI..F..GTFP.CLA..VVL. | |
| Retrocopy | VFIGEFV*GTFPECLAYHVVLR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017491 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000007398 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000003106 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000016853 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000016782 | 1 retrocopy | |
| Homo sapiens | ENSG00000062582 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000005692 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000011905 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000002405 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000013889 | 1 retrocopy |
retro_mdom_1785 ,
|
| Pan troglodytes | ENSPTRG00000019127 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000015911 | 4 retrocopies | |
| Tursiops truncatus | ENSTTRG00000002938 | 1 retrocopy |