>retro_mdom_1486
ATGAGGCTCCTCAGCATATTCCTGCTGCTCTCCGTGGCTCTGTGCTGCTTCTTGGATACTGTTCAAGCTAAAAAATTCCC
CCGAAAGGCTATTTGTCCTTCCAAAATTCCTGGATGCTCAAGACACTATAGACCGATCTGGGGCACTGATGATCGTAGTT
ATGGCAATCACTGTGTTCTGTGTCAGAAAAACAAGAACAGAGAAGTTCAGGTCCTCATCCCAAAATATGGAGAATGC
ORF - retro_mdom_1486 Open Reading Frame is conserved.
Retrocopy - Parental Gene Alignment summary:
| Percent Identity: |
68.35 % |
| Parental protein coverage: |
100. % |
| Number of stop codons detected: |
0 |
| Number of frameshifts detected |
0 |
Retrocopy - Parental Gene Alignment:
| Parental | MRILAIFLLLSMALCCFMDTVQAQDFPREATCPPEISGCSRHYKPICGTDGLTYDNQCNLCEENKYRKVQ |
| | MR.L.IFLLLS.ALCCF.DTVQA..FPR.A.CP..I.GCSRHY.PI.GTD...Y.N.C.LC..NK.R.VQ |
| Retrocopy | MRLLSIFLLLSVALCCFLDTVQAKKFPRKAICPSKIPGCSRHYRPIWGTDDRSYGNHCVLCQKNKNREVQ |
|
| Parental | VLIQKYGKC |
| | VLI.KYG.C |
| Retrocopy | VLIPKYGEC |
|
Legend:
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)
Expression validation based on RNA-Seq data:
| Library |
Retrocopy expression |
Parental gene expression |
| SRP007412_brain |
0 .00 RPM |
0 .00 RPM |
| SRP007412_cerebellum |
0 .00 RPM |
0 .00 RPM |
| SRP007412_heart |
0 .00 RPM |
0 .20 RPM |
| SRP007412_kidney |
0 .00 RPM |
5 .27 RPM |
| SRP007412_liver |
0 .00 RPM |
0 .00 RPM |
| SRP007412_testis |
0 .00 RPM |
0 .00 RPM |
Monodelphis domestica was not studied using ChIP-Seq data.
No EST(s) were mapped for retro_mdom_1486 retrocopy.
Monodelphis domestica was not studied using FANTOM5 data.
retro_mdom_1486 was not experimentally validated.
Retrocopy orthology:
Monodelphis domestica does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to
help section.
Parental genes homology:
Parental genes homology involve
1 parental gene, and
2 retrocopies.