RetrogeneDB ID: | retro_lafr_712 | ||
Retrocopylocation | Organism: | Elephant (Loxodonta africana) | |
| Coordinates: | scaffold_32:9848997..9849230(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSLAFG00000027950 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSLAFG00000017910 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 77.22 % |
| Parental protein coverage: | 89.53 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | MELSAENL-REKLQRELEAEHVEV-EDTTLNRCACSFRVLVVSSKFEGKPLLQRHRLVNACLAEELPHIH |
| MELSAE.L.R.KL.REL.AEH.EV.EDT.LNRC..SFRVLVVSS.F.GK.LLQ.H.LV.ACLAEEL.HIH | |
| Retrocopy | MELSAEYL>RQKL*RELKAEHEEV>EDTALNRCVFSFRVLVVSSEFQGKQLLQTHWLVTACLAEELLHIH |
| Parental | AFEQKTLTP |
| AFEQKTL.P | |
| Retrocopy | AFEQKTLNP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000006661 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000006548 | 1 retrocopy | |
| Homo sapiens | ENSG00000169627 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000012724 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000017910 | 1 retrocopy |
retro_lafr_712 ,
|
| Myotis lucifugus | ENSMLUG00000003449 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000007331 | 3 retrocopies | |
| Monodelphis domestica | ENSMODG00000015658 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000001018 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000007562 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000002109 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000007237 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000007990 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000047988 | 2 retrocopies | |
| Sorex araneus | ENSSARG00000003579 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000006274 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000005543 | 2 retrocopies |