RetrogeneDB ID: | retro_itri_1624 | ||
Retrocopylocation | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393579.1:1498061..1498298(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | VHL | ||
| Ensembl ID: | ENSSTOG00000013959 | ||
| Aliases: | None | ||
| Description: | von Hippel-Lindau tumor suppressor, E3 ubiquitin protein ligase [Source:HGNC Symbol;Acc:12687] |
| Percent Identity: | 58.02 % |
| Parental protein coverage: | 50.31 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | YPTLPPGTGRRIHSYRGHLWLFRDAGTYDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVR |
| ..T..PG....IHSYR.HLWLFRDAGT.DGLLVN.TELFVPSLNVDGQPIF....L......ER...... | |
| Retrocopy | HQTVLPGRNLSIHSYRDHLWLFRDAGTDDGLLVNLTELFVPSLNVDGQPIFLPASLWPCVYPERAMPA-- |
| Parental | SLVKPENYRRL |
| ...KP...R.L | |
| Retrocopy | GCAKPSQAREL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Gorilla gorilla | ENSGGOG00000010456 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000007587 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000013663 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000013959 | 1 retrocopy |
retro_itri_1624 ,
|