RetrogeneDB ID: | retro_ggor_801 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 12:56587578..56587952(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ARF1 | ||
| Ensembl ID: | ENSGGOG00000011263 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 71.43 % |
| Parental protein coverage: | 69.06 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 1 |
| Parental | EYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVF-A |
| E..NISFTVWD..GQ.KI.PLW.HYFQNT.GLIF..D..DRE..N.A.EELMRMLAEDEL..AV.LVF.. | |
| Retrocopy | ESRNISFTVWDMAGQHKIWPLWCHYFQNT*GLIFMEDGSDREHMNKAHEELMRMLAEDELWNAVPLVF<P |
| Parental | NKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK |
| NK..L.N.MN..EITDKLGLHSL.HR.WYIQATC.T.GD.L.EGLDWLS.QL.N.K | |
| Retrocopy | NK*ALLNTMNTTEITDKLGLHSLLHRKWYIQATCGTCGDQLHEGLDWLSSQLQN*K |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 217 .85 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 174 .61 RPM |
| SRP007412_heart | 0 .00 RPM | 116 .73 RPM |
| SRP007412_kidney | 0 .00 RPM | 196 .80 RPM |
| SRP007412_liver | 0 .00 RPM | 170 .85 RPM |
| SRP007412_testis | 0 .00 RPM | 303 .65 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Pongo abelii | retro_pabe_849 |
| Macaca mulatta | retro_mmul_810 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000016671 | 10 retrocopies | |
| Cavia porcellus | ENSCPOG00000021174 | 1 retrocopy | |
| Ciona savignyi | ENSCSAVG00000007011 | 1 retrocopy | |
| Felis catus | ENSFCAG00000029374 | 1 retrocopy | |
| Homo sapiens | ENSG00000143761 | 3 retrocopies | |
| Gallus gallus | ENSGALG00000005393 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000000294 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000004952 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000011263 | 5 retrocopies | |
| Gorilla gorilla | ENSGGOG00000016749 | 1 retrocopy | |
| Latimeria chalumnae | ENSLACG00000019009 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000007020 | 6 retrocopies | |
| Mus musculus | ENSMUSG00000048076 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000023645 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000002066 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000009218 | 9 retrocopies | |
| Tetraodon nigroviridis | ENSTNIG00000011685 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000014186 | 2 retrocopies |