RetrogeneDB ID: | retro_ggor_796 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 12:47660305..47660536(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | COX5B | ||
| Ensembl ID: | ENSGGOG00000001142 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 61.25 % |
| Parental protein coverage: | 60.47 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | MASRLLRGAGTLAAQA-LRARGPSGAAAVRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNILAPKG |
| MASRL...AG.LAA.A.LRA..P.G..AV..MASGGG.PTD..Q.TGLERE.M.A......P.....PKG | |
| Retrocopy | MASRLIFRAGALAA*A<LRAYSPNGVVAVCFMASGGGIPTDDKQMTGLEREFMIAMYE-IGPIQYITPKG |
| Parental | -ASGTREDPN |
| .ASGTREDPN | |
| Retrocopy | >ASGTREDPN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .10 RPM | 100 .75 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 67 .61 RPM |
| SRP007412_heart | 0 .00 RPM | 199 .75 RPM |
| SRP007412_kidney | 0 .04 RPM | 153 .66 RPM |
| SRP007412_liver | 0 .00 RPM | 70 .82 RPM |
| SRP007412_testis | 0 .00 RPM | 45 .69 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_997 |
| Pan troglodytes | retro_ptro_754 |