RetrogeneDB ID: | retro_ggor_795 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 12:47549082..47549459(+) | ||
| Located in intron of: | ENSGGOG00000001570 | ||
Retrocopyinformation | Ensembl ID: | ENSGGOG00000024133 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | PARK7 | ||
| Ensembl ID: | ENSGGOG00000012105 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 66.67 % |
| Parental protein coverage: | 80.65 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | GPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAAPFIILS--LARGCVVTLLPKPISKNK |
| GPYD...LPGGNLGAQNL.ESA.VKEILKEQEN.KGLIA.ICA.P..........G..VT.LP....K.K | |
| Retrocopy | GPYDIIILPGGNLGAQNLPESASVKEILKEQENQKGLIATICAGPTALMAHEISFGSKVTTLP--LAKDK |
| Parental | KISAGHYTYSENRVEKDGL-ILTSRG-PGTSFEFALAIVEALNGKEVAAQVKAPLVLKD |
| .....HYTYSENRVEKDGL..L...G.P.TSFEF.L.IVEAL..KE.AAQVKAPLVLKD | |
| Retrocopy | MMNGSHYTYSENRVEKDGLKFLQAQG<PRTSFEFVLTIVEALSSKEMAAQVKAPLVLKD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 11 .03 RPM | 133 .50 RPM |
| SRP007412_cerebellum | 6 .70 RPM | 101 .25 RPM |
| SRP007412_heart | 3 .91 RPM | 53 .69 RPM |
| SRP007412_kidney | 11 .86 RPM | 134 .40 RPM |
| SRP007412_liver | 5 .43 RPM | 75 .78 RPM |
| SRP007412_testis | 12 .33 RPM | 98 .52 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_995 |
| Pongo abelii | retro_pabe_840 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000003703 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000019674 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000004364 | 7 retrocopies | |
| Callithrix jacchus | ENSCJAG00000000319 | 4 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000013141 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000010915 | 1 retrocopy | |
| Homo sapiens | ENSG00000116288 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000012105 | 2 retrocopies |
retro_ggor_2812, retro_ggor_795 ,
|
| Microcebus murinus | ENSMICG00000008470 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000008790 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000016511 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000002151 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000001925 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000000102 | 3 retrocopies | |
| Rattus norvegicus | ENSRNOG00000018289 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000009474 | 13 retrocopies | |
| Tarsius syrichta | ENSTSYG00000001455 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000011076 | 1 retrocopy |