RetrogeneDB ID: | retro_ggor_3051 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | X:100878838..100879191(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSGGOG00000024590 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | CNEP1R1 | ||
| Ensembl ID: | ENSGGOG00000025211 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 91.6 % |
| Parental protein coverage: | 83.1 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | QDLKAFERRLTEYIHCLQPATGRWRMLLIVVSVCT-ATGAWNWLIDPETQKVSFFTSLWNHPFFTISCIT |
| ..LKAFERRLTEYIHCLQPATG.WRMLL.VVSVCT.ATGAWNWLIDPETQKVSFFTSLWNHPFFTIS.IT | |
| Retrocopy | EELKAFERRLTEYIHCLQPATGCWRMLLLVVSVCT<ATGAWNWLIDPETQKVSFFTSLWNHPFFTISYIT |
| Parental | LIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKPRPHVQ |
| LIGLFFAGIHKRVVAPSIIAA...T.LAEYNMSCDDTGKLILKPRPHVQ | |
| Retrocopy | LIGLFFAGIHKRVVAPSIIAAQRQTILAEYNMSCDDTGKLILKPRPHVQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 7 .19 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 8 .04 RPM |
| SRP007412_heart | 0 .00 RPM | 1 .66 RPM |
| SRP007412_kidney | 0 .00 RPM | 7 .73 RPM |
| SRP007412_liver | 0 .08 RPM | 8 .34 RPM |
| SRP007412_testis | 0 .00 RPM | 16 .99 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_4886 |
| Pan troglodytes | retro_ptro_3255 |
| Pongo abelii | retro_pabe_3799 |
| Macaca mulatta | retro_mmul_2624 |
| Callithrix jacchus | retro_cjac_4204 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000006491 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000001997 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000012791 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000005737 | 1 retrocopy | |
| Felis catus | ENSFCAG00000023936 | 1 retrocopy | |
| Homo sapiens | ENSG00000205423 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000025211 | 1 retrocopy |
retro_ggor_3051 ,
|
| Loxodonta africana | ENSLAFG00000012573 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000006900 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000008365 | 3 retrocopies | |
| Mustela putorius furo | ENSMPUG00000003109 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000727 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000005923 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000015665 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000007335 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000041682 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000001179 | 1 retrocopy |