RetrogeneDB ID: | retro_ggor_2192 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 5:85893336..85893713(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSGGOG00000027517 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | EIF3K | ||
| Ensembl ID: | ENSGGOG00000016808 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 81.89 % |
| Parental protein coverage: | 58.06 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | NQEERP-IRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEM |
| .QEE.P.I.QILYL.DLLET..FQAFW.ALDEN.DLLEGITGFEDSVR..IC.VVGITYQHID.WLLAEM | |
| Retrocopy | HQEEWP<I*QILYLKDLLETSLFQAFWEALDENVDLLEGITGFEDSVRMCICPVVGITYQHIDHWLLAEM |
| Parental | LGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ |
| .G.LSDSQLKVWM.KY.W.ADES.QIFICSQEE.IKPKN.VEKIDFDSVSSIMA..Q | |
| Retrocopy | PGYLSDSQLKVWMRKYTWRADESRQIFICSQEENIKPKNPVEKIDFDSVSSIMAFFQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 51 .93 RPM |
| SRP007412_cerebellum | 0 .12 RPM | 51 .34 RPM |
| SRP007412_heart | 0 .09 RPM | 34 .40 RPM |
| SRP007412_kidney | 0 .12 RPM | 70 .25 RPM |
| SRP007412_liver | 0 .03 RPM | 57 .19 RPM |
| SRP007412_testis | 0 .00 RPM | 41 .23 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3224 |
| Pan troglodytes | retro_ptro_2176 |
| Pongo abelii | retro_pabe_2673 |
| Macaca mulatta | retro_mmul_2029 |
| Macaca mulatta | retro_mmul_2098 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Echinops telfairi | ENSETEG00000007594 | 3 retrocopies | |
| Homo sapiens | ENSG00000178982 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000016808 | 1 retrocopy |
retro_ggor_2192 ,
|
| Myotis lucifugus | ENSMLUG00000010217 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000028767 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000013314 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000026260 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000025857 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000010934 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000020495 | 3 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000005313 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000007001 | 1 retrocopy |