RetrogeneDB ID: | retro_ggor_1361 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 17:93826196..93826445(-) | ||
| Located in intron of: | ENSGGOG00000013694 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | FAM136A | ||
| Ensembl ID: | ENSGGOG00000023247 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 59.04 % |
| Parental protein coverage: | 60.14 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | VQEAVESMVKSLERENIRKMQGLMFRCSASCCEDSQASMKQVHQCIERCHVPLAQAQALVTSELEKFQDR |
| VQEA..SMVK........KMQGLM..CS.S.CEDS...M.QVH......HVPLAQAQALVT..LEK.QDR | |
| Retrocopy | VQEAADSMVKNWRERELQKMQGLMIWCSTSYCEDSRVPMQQVHPGLQHGHVPLAQAQALVTGKLEKSQDR |
| Parental | LARCTMHCNDKAK |
| L...T.H..DKA. | |
| Retrocopy | LTGGTRHYSDKAR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 14 .96 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 11 .86 RPM |
| SRP007412_heart | 0 .00 RPM | 2 .97 RPM |
| SRP007412_kidney | 0 .00 RPM | 24 .82 RPM |
| SRP007412_liver | 0 .00 RPM | 18 .25 RPM |
| SRP007412_testis | 0 .00 RPM | 12 .02 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3136 |
| Pan troglodytes | retro_ptro_2120 |
| Pongo abelii | retro_pabe_2618 |