RetrogeneDB ID: | retro_ggor_1255 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 16:11769576..11769925(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MRPL18 | ||
| Ensembl ID: | ENSGGOG00000014075 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 55.37 % |
| Parental protein coverage: | 66.11 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 2 |
| Parental | ARKERGWRTVFPSREFWHRLRVIRTQHHVEALVEHQSGKVVVSASTREWAIK-KHLYSTRNVVACESIGR |
| A....G..T...S.EF.H...V.RTQ.H..ALVEH..G.VV.SAS..E..IK.KH..ST.NV...E.I.. | |
| Retrocopy | AAEKQGSATHLSSSEFRHGW*VPRTQQH-KALVEHPNGQVVISASSYECTIK<KHRSSTKNVTG-ENIRQ |
| Parental | VLAQ-RCLEAGINFMVYQPTPWEAASDSMKRLQSAMTEGGVVLREPQRIYE |
| .LA....L.AGINFMVYQP.PWEAA.DSM..L.SA.T.G.V..REP.RI.E | |
| Retrocopy | LLAE<ARLKAGINFMVYQPDPWEAALDSMRQL*SAKTGGAVAPREPRRICE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 22 .15 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 15 .33 RPM |
| SRP007412_heart | 0 .00 RPM | 9 .76 RPM |
| SRP007412_kidney | 0 .00 RPM | 24 .62 RPM |
| SRP007412_liver | 0 .03 RPM | 20 .05 RPM |
| SRP007412_testis | 0 .41 RPM | 38 .75 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1664 |
| Pan troglodytes | retro_ptro_1128 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000015398 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000011514 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000007591 | 1 retrocopy | |
| Homo sapiens | ENSG00000112110 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000014075 | 1 retrocopy |
retro_ggor_1255 ,
|
| Macaca mulatta | ENSMMUG00000017037 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000057388 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000007327 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000017147 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000018761 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000005322 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000005598 | 1 retrocopy |