RetrogeneDB ID: | retro_ggor_1067 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 14:73095371..73095662(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | CMC1 | ||
| Ensembl ID: | ENSGGOG00000012406 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 84.85 % |
| Parental protein coverage: | 86.61 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 2 |
| Parental | LRHVEKDVLIPKIMREKAKERCSE-QVQDFTKCCKNSGVLMVVKCRKENSALKEC-LTAYYNDPAFYEEC |
| LR.VEKDVLIPKIMREKA.ER.S..QVQDFTKCCKNSG.LMVVKC.KENSALKEC.LTA.YNDPAFYE.C | |
| Retrocopy | LRRVEKDVLIPKIMREKARERSSD<QVQDFTKCCKNSGILMVVKCWKENSALKEC>LTAHYNDPAFYE*C |
| Parental | KMEYLKEREEFRKTGIPTKKRLQKLPTSM |
| K.EYLKE.EEFRKTGI.TKK.LQKLPTS. | |
| Retrocopy | KVEYLKEKEEFRKTGISTKKSLQKLPTSV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 2 .59 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 1 .34 RPM |
| SRP007412_heart | 0 .00 RPM | 2 .66 RPM |
| SRP007412_kidney | 0 .00 RPM | 7 .97 RPM |
| SRP007412_liver | 0 .03 RPM | 7 .36 RPM |
| SRP007412_testis | 0 .00 RPM | 7 .67 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1372 |
| Pan troglodytes | retro_ptro_942 |
| Pongo abelii | retro_pabe_1139 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000004272 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000018923 | 2 retrocopies | |
| Homo sapiens | ENSG00000187118 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000012406 | 4 retrocopies | |
| Microcebus murinus | ENSMICG00000011702 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000000044 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000004066 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000012793 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000009474 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000014054 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000014706 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000010149 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000001629 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000002573 | 4 retrocopies | |
| Tarsius syrichta | ENSTSYG00000011371 | 2 retrocopies |