RetrogeneDB ID: | retro_gacu_18 | ||
Retrocopylocation | Organism: | Stickleback (Gasterosteus aculeatus) | |
| Coordinates: | groupVII:11969110..11969264(+) | ||
| Located in intron of: | ENSGACG00000020129 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSGACG00000006261 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 55.77 % |
| Parental protein coverage: | 51. % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | VVPRVLKSRMGARAFSYQDPLLSSQLPLSV-RGADSVSNWHSCVSSPLISTS |
| ..PRVLKSR.GAR.FS.Q..LLS.QL.LSV..GAD.VS.........L.S.S | |
| Retrocopy | LLPRVLKSRIGARTFSHQSSLLSDQLLLSV>GGADTVSSFKTRLMVFLLSGS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Gasterosteus aculeatus | ENSGACG00000006261 | 1 retrocopy |
retro_gacu_18 ,
|