RetrogeneDB ID: | retro_fcat_632 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
| Coordinates: | B1:81451066..81451467(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | ATP6V1D | ||
| Ensembl ID: | ENSFCAG00000011078 | ||
| Aliases: | None | ||
| Description: | ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D [Source:HGNC Symbol;Acc:13527] |
| Percent Identity: | 75.18 % |
| Parental protein coverage: | 53.44 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 3 |
| Parental | QTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLAEAKFTAGDFSTTVIQNV-NKAQVKIR |
| QTG.NLLKKKSD.LTL..RQILKKIIET.M.M.EVMREAAFS.AEAKFTA....TTVI..V.NKAQVK.. | |
| Retrocopy | QTG*NLLKKKSDVLTLPLRQILKKIIETNM*MAEVMREAAFSFAEAKFTARHLCTTVIYKV<NKAQVKLP |
| Parental | AKKDN-VAGVTLPVFEH-YHEGTDSYELTGLARG-GEQLAKLKRNYAKAVELLVE-LASLQTSFVTL |
| .KKDN..AGVTLPVFE.....GTDS.ELTGLARG.G.Q.AKLKRN.AKAVE.LVE..AS.QTSFVTL | |
| Retrocopy | EKKDNSSAGVTLPVFEY<FPQGTDSCELTGLARG>GAQPAKLKRN*AKAVEVLVEGVASVQTSFVTL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 49 .01 RPM |
| SRP017611_kidney | 0 .00 RPM | 48 .33 RPM |
| SRP017611_liver | 0 .00 RPM | 15 .97 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000008240 | 1 retrocopy | |
| Bos taurus | ENSBTAG00000016309 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000016369 | 2 retrocopies | |
| Choloepus hoffmanni | ENSCHOG00000003733 | 5 retrocopies | |
| Cavia porcellus | ENSCPOG00000009085 | 1 retrocopy | |
| Felis catus | ENSFCAG00000011078 | 1 retrocopy |
retro_fcat_632 ,
|
| Myotis lucifugus | ENSMLUG00000006244 | 5 retrocopies | |
| Macaca mulatta | ENSMMUG00000021418 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000009896 | 5 retrocopies | |
| Mustela putorius furo | ENSMPUG00000007002 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000015052 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000002288 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000027710 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000005696 | 1 retrocopy | |
| Drosophila melanogaster | FBgn0040377 | 1 retrocopy |