RetrogeneDB ID: | retro_fcat_565 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
| Coordinates: | B1:124520946..124521359(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | JOSD1 | ||
| Ensembl ID: | ENSFCAG00000002821 | ||
| Aliases: | None | ||
| Description: | Josephin domain containing 1 [Source:HGNC Symbol;Acc:28953] |
| Percent Identity: | 65.71 % |
| Parental protein coverage: | 67.82 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 2 |
| Parental | KAKSESVELPQAAPPQIYHEK-QRRELCALHALNNVFQDSNAFTRETLQEIFQRLSPNTMV-TPHKK-SM |
| ...SES.ELPQAA.PQIY.EK.Q.R.L.ALHA..N.F.DS.AF..E.LQEI.QRLS.NT.V..P.....M | |
| Retrocopy | ESESESLELPQAASPQIYREK>QHRDLRALHAFRNNFKDSSAFAQEMLQEILQRLSLNTTV>SPRREQNM |
| Parental | LGNGNYDVNVIMAALQTKGYEAVWWDKRRDVSAIALTNVMGFIMNLPSSLCWGPLKLPLKRQHWICVREV |
| LGNGN.DVNVIM.A.Q.K.Y.AV.WD.R.DVSAIAL...MGFI..LPSS.C...LKLPL.RQHWICV.EV | |
| Retrocopy | LGNGN*DVNVIMVAVQAKAYDAVRWDERSDVSAIALAKIMGFIVHLPSSRCFS-LKLPLNRQHWICV*EV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 17 .79 RPM |
| SRP017611_kidney | 0 .00 RPM | 7 .63 RPM |
| SRP017611_liver | 0 .00 RPM | 6 .17 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000010171 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000001379 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000001723 | 2 retrocopies | |
| Equus caballus | ENSECAG00000015546 | 1 retrocopy | |
| Felis catus | ENSFCAG00000002821 | 1 retrocopy |
retro_fcat_565 ,
|
| Macropus eugenii | ENSMEUG00000002899 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000011798 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000003764 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000022426 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000007520 | 3 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000010148 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000014440 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000015931 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000024999 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000008846 | 1 retrocopy |