RetrogeneDB ID: | retro_fcat_414 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
| Coordinates: | A3:10152835..10153048(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | HIGD1A | ||
| Ensembl ID: | ENSFCAG00000000537 | ||
| Aliases: | None | ||
| Description: | HIG1 hypoxia inducible domain family, member 1A [Source:HGNC Symbol;Acc:29527] |
| Percent Identity: | 85.92 % |
| Parental protein coverage: | 73.2 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | IRKAREAPFVPIGMAGFAAIVAYGLYRLKSRGNTKMSVHLIHMRVAAQGFVVGAMTLGMGYSMYKEFWAK |
| IRKAREAPFVP.GMAGFAAIVAYG.Y.LKSRG.T..SV.LIH.RVAAQGFVVGAMTLGMGY.M.KEFWAK | |
| Retrocopy | IRKAREAPFVPGGMAGFAAIVAYGPYQLKSRGGTRRSVQLIHVRVAAQGFVVGAMTLGMGYPMCKEFWAK |
| Parental | P |
| P | |
| Retrocopy | P |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 26 .51 RPM |
| SRP017611_kidney | 0 .10 RPM | 5 .77 RPM |
| SRP017611_liver | 0 .00 RPM | 5 .16 RPM |