RetrogeneDB ID: | retro_fcat_1139 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
| Coordinates: | C1:159104931..159105276(+) | ||
| Located in intron of: | ENSFCAG00000012076 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | H1FOO | ||
| Ensembl ID: | ENSFCAG00000000094 | ||
| Aliases: | None | ||
| Description: | H1 histone family, member O, oocyte-specific [Source:HGNC Symbol;Acc:18463] |
| Percent Identity: | 68.7 % |
| Parental protein coverage: | 54.81 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | KSKVKGRRSNQDGEAHRKTKAGSQNSKSTVPKDKNSVASPAKKKENKVLKEVVACGAKVGPKAKATAPPR |
| ..K..GRRS.QDGEA.RKTKA.S..SKS.VPKDKNS.ASPAKKKE.KV.KEVVA.G.K.GPKAKA.A.PR | |
| Retrocopy | ENKTNGRRSSQDGEAPRKTKAESWSSKSMVPKDKNSAASPAKKKEDKVPKEVVAHGVKEGPKAKAPATPR |
| Parental | ASGSKTVPAPLARKTGAPKGPRKP-CMPTKASSSKLASKKTEAES |
| ..GSK.V..PLARKT.AP.....P.C..TKASS..LASKK.E.ES | |
| Retrocopy | GGGSKRVSGPLARKTEAPRAQEGPACRITKASSFRLASKKLETES |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 0 .00 RPM |
| SRP017611_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP017611_liver | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000017209 | 2 retrocopies | |
| Felis catus | ENSFCAG00000000094 | 2 retrocopies |
retro_fcat_1139 , retro_fcat_416,
|
| Homo sapiens | ENSG00000178804 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000000735 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000025226 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000029379 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000010371 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000013414 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000015380 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000007110 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000011276 | 1 retrocopy |