RetrogeneDB ID: | retro_fcat_1131 | ||
Retrocopylocation | Organism: | Cat (Felis catus) | |
| Coordinates: | C1:142054093..142054318(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | PPP1R1A | ||
| Ensembl ID: | ENSFCAG00000010159 | ||
| Aliases: | None | ||
| Description: | protein phosphatase 1, regulatory (inhibitor) subunit 1A [Source:HGNC Symbol;Acc:9286] |
| Percent Identity: | 54.67 % |
| Parental protein coverage: | 52.08 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 0 |
| Parental | QIRRRRPTPATLVLTSDQSSPEIDEDRIPNPLLKSTLSMSPRQRKKVTRTTPTMKELQMMVEHHLGQQQQ |
| QI.R.RPT.ATL.LTSDQSSPEIDED.IPN..LKS.L..SP...KKV.RTT.TMK............... | |
| Retrocopy | QILRHRPTSATLMLTSDQSSPEIDEDWIPNLPLKSILAISPQHWKKVRRTTSTMKNPSLKLRRGAERNPS |
| Parental | GEEPE |
| ...P. | |
| Retrocopy | QRNPQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 16 .53 RPM |
| SRP017611_kidney | 0 .00 RPM | 57 .30 RPM |
| SRP017611_liver | 0 .00 RPM | 16 .17 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Felis catus | ENSFCAG00000010159 | 1 retrocopy |
retro_fcat_1131 ,
|
| Homo sapiens | ENSG00000135447 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000008380 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000004608 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000005044 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000001193 | 20 retrocopies |
retro_tbel_1191, retro_tbel_1233, retro_tbel_1251, retro_tbel_1264, retro_tbel_138, retro_tbel_1881, retro_tbel_2036, retro_tbel_2437, retro_tbel_2574, retro_tbel_2720, retro_tbel_3243, retro_tbel_3316, retro_tbel_3377, retro_tbel_3380, retro_tbel_3414, retro_tbel_3426, retro_tbel_4551, retro_tbel_537, retro_tbel_669, retro_tbel_899,
|