RetrogeneDB ID: | retro_etel_491 | ||
Retrocopylocation | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | GeneScaffold_8216:200644..200873(+) | ||
| Located in intron of: | ENSETEG00000008048 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NAA38 | ||
| Ensembl ID: | ENSETEG00000011594 | ||
| Aliases: | None | ||
| Description: | N(alpha)-acetyltransferase 38, NatC auxiliary subunit [Source:HGNC Symbol;Acc:20471] |
| Percent Identity: | 59.26 % |
| Parental protein coverage: | 83.33 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | VAVITSDGRMIVGTLKGFDQTINLILDESHERVFSS-SQGVEQVVLGLYIVRGDNVAVIGEIDEETDSAL |
| ...I.SD.R..VGTL....QT..LILDES.ERV....S.GV.QVV.....VRG.N.A..GEIDEETDS.L | |
| Retrocopy | LSLINSDRRTDVGTLESCNQTMSLILDESQERVIAL>SRGVGQVVM----VRGANAAGTGEIDEETDSVL |
| Parental | DLGNIRAEPLN |
| DLG.I.AEP.N | |
| Retrocopy | DLGSI*AEP*N |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000001162 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000011594 | 1 retrocopy |
retro_etel_491 ,
|
| Felis catus | ENSFCAG00000023642 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000006837 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000015822 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000007100 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000017359 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000013377 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000014809 | 2 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000018435 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000009039 | 3 retrocopies |