RetrogeneDB ID: | retro_etel_2106 | ||
Retrocopylocation | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_61812:516..697(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | MRPL33 | ||
| Ensembl ID: | ENSETEG00000003239 | ||
| Aliases: | None | ||
| Description: | mitochondrial ribosomal protein L33 [Source:HGNC Symbol;Acc:14487] |
| Percent Identity: | 50.82 % |
| Parental protein coverage: | 92.31 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected | 1 |
| Parental | FLTAVSFARSKSKNILV-KMLSQAGTGYTFNTKRSRLREKLTLLRYDPVVQKKVLFVEQKK |
| FL...S.A.S.....LV.K..SQAGTG.TFNTKR..L..K.TLL.Y....Q...LF.E..K | |
| Retrocopy | FLPTISSAKSNASKQLV>KIMSQAGTG*TFNTKRQQL*QKQTLLQYSNDEQNIFLFCETGK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000015881 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000003239 | 2 retrocopies |
retro_etel_2106 , retro_etel_322,
|
| Mus musculus | ENSMUSG00000029142 | 2 retrocopies |