RetrogeneDB ID: | retro_etel_2068 | ||
Retrocopylocation | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_46189:206..440(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSETEG00000019040 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | GABARAP | ||
| Ensembl ID: | ENSETEG00000004652 | ||
| Aliases: | None | ||
| Description: | GABA(A) receptor-associated protein [Source:HGNC Symbol;Acc:4067] |
| Percent Identity: | 81.48 % |
| Parental protein coverage: | 66.67 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 3 |
| Parental | MKFVYKEEHPFEKRRSEGEKIRKKYPD-RVPVIVEKAPKARIGDLDKKKYLVPSDLT-VGQF-YFLIRKR |
| MKFVYKE.HPFEKRRSEG.KIRKKYPD.RV....EKAPKARIG.LDKKKY.VPSDLT..GQF..FLI..R | |
| Retrocopy | MKFVYKEKHPFEKRRSEGKKIRKKYPD>RV-LVIEKAPKARIGGLDKKKYPVPSDLT>LGQF>HFLIPER |
| Parental | IHLRAEDALFF |
| IHLRAEDALFF | |
| Retrocopy | IHLRAEDALFF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ciona intestinalis | ENSCING00000012473 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000004652 | 7 retrocopies |
retro_etel_1020, retro_etel_1078, retro_etel_1562, retro_etel_2068 , retro_etel_493, retro_etel_666, retro_etel_976,
|
| Echinops telfairi | ENSETEG00000012407 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000015189 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000000744 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000010545 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000010473 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000004388 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000017936 | 1 retrocopy | |
| Drosophila melanogaster | FBgn0052672 | 1 retrocopy |