RetrogeneDB ID: | retro_etel_202 | ||
Retrocopylocation | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | GeneScaffold_3521:21715..21964(+) | ||
| Located in intron of: | ENSETEG00000005210 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | DYNLT1 | ||
| Ensembl ID: | ENSETEG00000013883 | ||
| Aliases: | None | ||
| Description: | dynein, light chain, Tctex-type 1 [Source:HGNC Symbol;Acc:11697] |
| Percent Identity: | 77.11 % |
| Parental protein coverage: | 73.45 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | AIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRW |
| .IG.NAY.H.KVN.WTTNV.EQT.S.L.KLGKP.K.I.T.V.MQKNGA.L.TASSCFW.SSTDGSCTV.W | |
| Retrocopy | SIGRNAYPHGKVN*WTTNVGEQTQSWLSKLGKPLKCIGTSVLMQKNGARLSTASSCFWESSTDGSCTVCW |
| Parental | ENKSMYCIVSTFG |
| ENK.MYCIVSTFG | |
| Retrocopy | ENKTMYCIVSTFG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000004472 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000003656 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000003718 | 3 retrocopies | |
| Dipodomys ordii | ENSDORG00000014053 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000013883 | 1 retrocopy |
retro_etel_202 ,
|
| Homo sapiens | ENSG00000146425 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000009979 | 3 retrocopies | |
| Microcebus murinus | ENSMICG00000009483 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000001922 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000019454 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000007654 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000095677 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000013012 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000000494 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000017135 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000018746 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000006273 | 1 retrocopy | |
| Tarsius syrichta | ENSTSYG00000003114 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000011340 | 2 retrocopies |