RetrogeneDB ID: | retro_etel_1744 | ||
Retrocopylocation | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
| Coordinates: | scaffold_291573:45447..45676(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NCMAP | ||
| Ensembl ID: | ENSETEG00000006813 | ||
| Aliases: | None | ||
| Description: | noncompact myelin associated protein [Source:HGNC Symbol;Acc:29332] |
| Percent Identity: | 86.08 % |
| Parental protein coverage: | 75.49 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | MTTVTPLGATTF-FSLNMTTRGEDFLYKSSGAIVAAIVVVVIVIFTVVLILLKMYNRKMRTRR-ELEPKG |
| MTTVTPLG.TTF.FSLNMTTRGEDFLY.S.G.IV.AIVVVVIVIFTVVLILLKMYNRKM.TR..ELEPKG | |
| Retrocopy | MTTVTPLGVTTF<FSLNMTTRGEDFLYESLGTIVTAIVVVVIVIFTVVLILLKMYNRKMGTRE<ELEPKG |
| Parental | PKPASSSAL |
| .KPAS.SAL | |
| Retrocopy | LKPASPSAL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000012604 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000006813 | 1 retrocopy |
retro_etel_1744 ,
|