>retro_etel_1241 ATGTCTCCCATTCAGCAGCTGGTAGGAAGATGGCATCAAGTAGATAGCAAAGGGATCGATGAATATGTGAGGGAGTTAGG
AGTGGGAAAAGCTTTGTAAAAAAAAAAAATGGGTGCAATGATCAAGCCTGACTGTGTCATGTCTAATGATGGCAAAACCC
TCACCATGAAAACCAGGAGCCTTTTGAAAACACCGTTTTCTTATAACCTGGGCGAAAAATCTGAAGCAACGATCATGATG
GCAGAAAAACTCAGTCTGTCTGCAATTTTACACATGGTGCTTTGATCCAAAACCAGGATGGGAAGGGGAGCCCAATAACA
AGACATTTGGAAGAATTAGAATTATTGGTGAAATGCATTTTGAACAATGTCACCTGTACTCAGACCTATGAAAAGGGAGA
A
ORF - retro_etel_1241 Open Reading Frame is not conserved.
Retrocopy - Parental Gene Alignment summary:
Percent Identity:
62.32 %
Parental protein coverage:
100. %
Number of stop codons detected:
0
Number of frameshifts detected
1
Retrocopy - Parental Gene Alignment:
Parental MATLEQFVGRWRLVDSKGFDEYMKELGVGMALRKM--GAMAKPDCIITCDGKTLTVKTESTLKTTQFSCN
M....Q.VGRW..VDSKG.DEY..ELGVG.AL.....GAM.KPDC....DGKTLT.KT.S.LKT..FS.N
Retrocopy MSPIQQLVGRWHQVDSKGIDEYVRELGVGKALXXXXXGAMIKPDCVMSNDGKTLTMKTRSLLKTP-FSYN Parental LGEKFEETTA-DGRKTQTVCDFADGALVQHQDWDGKQSTITRKLENGKLVVECVMNNVTCTRTYEKVE
LGEK.E.T...DGRKTQ.VC.F..GAL.Q.QD..GK.S.ITR.LE...L.V.C..NNVTCT.TYEK.E
Retrocopy LGEKSEATIM< DGRKTQSVCNFTHGALIQNQD--GKGSPITRHLEELELLVKCILNNVTCTQTYEKGE
Legend:
* Stop codon
> Forward frameshift by one nucleotide
< Reverse frameshift by one nucleotide
Echinops telfairi was not studied using RNA-Seq expression data.
Echinops telfairi was not studied using ChIP-Seq data.
Echinops telfairi was not studied using EST data.
Echinops telfairi was not studied using FANTOM5 data.
retro_etel_1241 was not experimentally validated.
Retrocopy orthology:
Echinops telfairi does not belong to any of the species groups (eutheria, teleost or neognath), studied for retrocopy-based homology. For more information about studied groups, please go to
help section.
Parental genes homology: Parental genes homology involve
27 parental genes, and
113 retrocopies.
Species
Parental gene accession
Retrocopies number
Ailuropoda melanoleuca ENSAMEG00000014619 1 retrocopy
Show / hide list of retrocopies
Bos taurus ENSBTAG00000047330 3 retrocopies
Show / hide list of retrocopies
Callithrix jacchus ENSCJAG00000000444 4 retrocopies
Show / hide list of retrocopies
Cavia porcellus ENSCPOG00000025732 1 retrocopy
Show / hide list of retrocopies
Dasypus novemcinctus ENSDNOG00000018066 5 retrocopies
Show / hide list of retrocopies
Equus caballus ENSECAG00000008270 2 retrocopies
Show / hide list of retrocopies
Erinaceus europaeus ENSEEUG00000014023 2 retrocopies
Show / hide list of retrocopies
Echinops telfairi ENSETEG00000007443 14 retrocopies
Show / hide list of retrocopies
retro_etel_1024 ,
retro_etel_1241 ,
retro_etel_1276 ,
retro_etel_1405 ,
retro_etel_1467 ,
retro_etel_1706 ,
retro_etel_1842 ,
retro_etel_1904 ,
retro_etel_2003 ,
retro_etel_512 ,
retro_etel_602 ,
retro_etel_620 ,
retro_etel_806 ,
retro_etel_994 ,
Felis catus ENSFCAG00000006032 2 retrocopies
Show / hide list of retrocopies
Homo sapiens ENSG00000164687 12 retrocopies
Show / hide list of retrocopies
retro_hsap_1205 ,
retro_hsap_1279 ,
retro_hsap_1520 ,
retro_hsap_1521 ,
retro_hsap_2167 ,
retro_hsap_2568 ,
retro_hsap_3000 ,
retro_hsap_3357 ,
retro_hsap_3376 ,
retro_hsap_3811 ,
retro_hsap_4717 ,
retro_hsap_880 ,
Gorilla gorilla ENSGGOG00000005964 8 retrocopies
Show / hide list of retrocopies
Latimeria chalumnae ENSLACG00000008511 3 retrocopies
Show / hide list of retrocopies
Macropus eugenii ENSMEUG00000002136 1 retrocopy
Show / hide list of retrocopies
Microcebus murinus ENSMICG00000001311 2 retrocopies
Show / hide list of retrocopies
Myotis lucifugus ENSMLUG00000009514 3 retrocopies
Show / hide list of retrocopies
Macaca mulatta ENSMMUG00000000486 4 retrocopies
Show / hide list of retrocopies
Mus musculus ENSMUSG00000027533 4 retrocopies
Show / hide list of retrocopies
Otolemur garnettii ENSOGAG00000002413 10 retrocopies
Show / hide list of retrocopies
retro_ogar_1024 ,
retro_ogar_1151 ,
retro_ogar_1286 ,
retro_ogar_1676 ,
retro_ogar_2873 ,
retro_ogar_3066 ,
retro_ogar_3099 ,
retro_ogar_3265 ,
retro_ogar_715 ,
retro_ogar_878 ,
Oryzias latipes ENSORLG00000008282 1 retrocopy
Show / hide list of retrocopies
Pongo abelii ENSPPYG00000018699 1 retrocopy
Show / hide list of retrocopies
Pan troglodytes ENSPTRG00000020373 12 retrocopies
Show / hide list of retrocopies
retro_ptro_1029 ,
retro_ptro_1030 ,
retro_ptro_1498 ,
retro_ptro_1654 ,
retro_ptro_2029 ,
retro_ptro_2131 ,
retro_ptro_2265 ,
retro_ptro_2295 ,
retro_ptro_2664 ,
retro_ptro_3135 ,
retro_ptro_823 ,
retro_ptro_875 ,
Pteropus vampyrus ENSPVAG00000017850 5 retrocopies
Show / hide list of retrocopies
Rattus norvegicus ENSRNOG00000049075 3 retrocopies
Show / hide list of retrocopies
Sus scrofa ENSSSCG00000006153 1 retrocopy
Show / hide list of retrocopies