RetrogeneDB ID: | retro_eeur_596 | ||
Retrocopylocation | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | scaffold_356968:15504..15740(-) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | DNAJC19 | ||
| Ensembl ID: | ENSEEUG00000006955 | ||
| Aliases: | None | ||
| Description: | DnaJ (Hsp40) homolog, subfamily C, member 19 [Source:HGNC Symbol;Acc:30528] |
| Percent Identity: | 55. % |
| Parental protein coverage: | 68.1 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | MASTVVAVGLTIAAAGFAGRYVLQAMKHVEPQVKQVFQSLPKSAFSGGYYRGGFEPK-MTKREAALILGV |
| MASTV.AVG.TIAA.GF....V.QA.KH.E..VK...Q.LPK.A.SG.Y...GFEP..M.K.......GV | |
| Retrocopy | MASTVAAVGMTIAATGFSDHHVSQAVKHMEREVK*MLQNLPKAAYSGDYHGSGFEPR<MIKQGVPTMPGV |
| Parental | SPTANKGKIR |
| SPT..K..IR | |
| Retrocopy | SPTSKKEQIR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 11 .44 RPM |
| SRP017611_kidney | 0 .00 RPM | 29 .82 RPM |
| SRP017611_liver | 0 .00 RPM | 16 .08 RPM |