RetrogeneDB ID: | retro_eeur_537 | ||
Retrocopylocation | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | scaffold_340907:69911..70155(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | PFDN1 | ||
| Ensembl ID: | ENSEEUG00000005357 | ||
| Aliases: | None | ||
| Description: | prefoldin subunit 1 [Source:HGNC Symbol;Acc:8866] |
| Percent Identity: | 87.8 % |
| Parental protein coverage: | 85.26 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 1 |
| Parental | LADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEVIHSQLLEKQKIAEEKIKELEQ-K |
| LADI..EQLNRTKKHAHLTDTEIMTLV.E.NMYEGVGRMFILQSKE.IHSQ.LEKQKI.EE.IKELEQ.K | |
| Retrocopy | LADI*TEQLNRTKKHAHLTDTEIMTLVHEINMYEGVGRMFILQSKEEIHSQMLEKQKISEENIKELEQ>K |
| Parental | KSYLERSVKEAE |
| KSYLERSVKEA. | |
| Retrocopy | KSYLERSVKEAQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 1 .61 RPM | 11 .28 RPM |
| SRP017611_kidney | 3 .00 RPM | 21 .00 RPM |
| SRP017611_liver | 1 .45 RPM | 9 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000005742 | 8 retrocopies | |
| Equus caballus | ENSECAG00000011843 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000005357 | 1 retrocopy |
retro_eeur_537 ,
|
| Echinops telfairi | ENSETEG00000019281 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000002726 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000003376 | 6 retrocopies |