RetrogeneDB ID: | retro_ecab_940 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
| Coordinates: | 7:85423425..85423722(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | PDZD11 | ||
| Ensembl ID: | ENSECAG00000010771 | ||
| Aliases: | None | ||
| Description: | PDZ domain containing 11 [Source:HGNC Symbol;Acc:28034] |
| Percent Identity: | 76.77 % |
| Parental protein coverage: | 70.71 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected | 0 |
| Parental | RVYHPDYNNELTQFLPRIVTLKKPPGAQLGFNIRGGKASQLGIFISKVIPDSDAHRAGLQEGDQVLAVND |
| RVY....NNEL..FLPRI.TLKKPPGAQ.GFNIRG.KASQL.IFIS.VIP.S.AH.AGLQEG.QVLAVND | |
| Retrocopy | RVYRACCNNELSHFLPRIITLKKPPGAQWGFNIRGRKASQLSIFISTVIPGSEAH*AGLQEGNQVLAVND |
| Parental | VDFQDIEHSKAVEILKTAREISMRVRFFP |
| VDFQD.EHSKAVEILKT..EISM.....P | |
| Retrocopy | VDFQDLEHSKAVEILKTTHEISMHACLLP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 7 .20 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 23 .63 RPM |
| SRP021940_embryo | 0 .08 RPM | 23 .42 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 22 .32 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 12 .60 RPM |
| SRP021940_testis | 0 .06 RPM | 11 .57 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Bos taurus | retro_btau_594 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000009203 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000028800 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000012432 | 1 retrocopy | |
| Equus caballus | ENSECAG00000010771 | 1 retrocopy |
retro_ecab_940 ,
|
| Echinops telfairi | ENSETEG00000008626 | 3 retrocopies | |
| Homo sapiens | ENSG00000120509 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000006626 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000012040 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000013938 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000004220 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000000863 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000016423 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000020929 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000021995 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000005380 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000002767 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000007864 | 1 retrocopy |