RetrogeneDB ID: | retro_ecab_838 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
| Coordinates: | 5:58704174..58704383(+) | ||
| Located in intron of: | ENSECAG00000011835 | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | NDUFS6 | ||
| Ensembl ID: | ENSECAG00000021690 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Q reductase) [Source:HGNC Symbol;Acc:7713] |
| Percent Identity: | 73.24 % |
| Parental protein coverage: | 56.45 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 1 |
| Parental | RLLGRGGGAALSLPG-GARCFGVRTSPTGEKVTHTGQAYGAEDYRRIRFVGRQKEVNENFAIDLIAEQPV |
| RLLG...GAA.S.PG.GAR.F.V.TSPTGEKVTH.GQ.Y...D..RIRFVG.QKEVNENFA.DLIAEQP. | |
| Retrocopy | RLLGWSRGAAPSPPG<GARHFRVWTSPTGEKVTHAGQVYDDGDDKRIRFVGHQKEVNENFATDLIAEQPM |
| Parental | S |
| S | |
| Retrocopy | S |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .30 RPM | 20 .96 RPM |
| SRP021940_cerebellum | 0 .42 RPM | 46 .01 RPM |
| SRP021940_embryo | 0 .59 RPM | 35 .75 RPM |
| SRP021940_placental_villous | 0 .24 RPM | 28 .19 RPM |
| SRP021940_synovial_membrane | 0 .49 RPM | 21 .28 RPM |
| SRP021940_testis | 0 .19 RPM | 44 .76 RPM |