RetrogeneDB ID: | retro_ecab_761 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
| Coordinates: | 31:17406837..17407159(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | FABP12 | ||
| Ensembl ID: | ENSECAG00000023552 | ||
| Aliases: | None | ||
| Description: | fatty acid binding protein 12 [Source:HGNC Symbol;Acc:34524] |
| Percent Identity: | 63.64 % |
| Parental protein coverage: | 81.82 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected | 2 |
| Parental | GIGRVSRKLGCLA-KPTVTINTKEDVITIKTKSIFKNNEISFKLGEEFEETTPAGRKIKSLVTLDNDSLV |
| GIGR..RK.GCLA.KPT....T..DVI..KTKSIFK.NEISFK...EFEET...G.KIKS.VTL.NDSL. | |
| Retrocopy | GIGRAGRKPGCLA<KPTEPNSTNGDVIAVKTKSIFKINEISFKWRGEFEETIAGGHKIKSTVTLGNDSLI |
| Parental | QVKDWEGKETTITRRLVDG-KMVVESAVNNVTCTQTYERV |
| QV.D..GKE.......VDG.KM...SAVNNVTCT.TYE.. | |
| Retrocopy | QVQDQVGKEPPVKGKSVDG<KMGQGSAVNNVTCTGTYESI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 0 .00 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP021940_embryo | 0 .00 RPM | 0 .03 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 0 .10 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 0 .00 RPM |
| SRP021940_testis | 0 .00 RPM | 5 .63 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000014554 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000000433 | 1 retrocopy | |
| Equus caballus | ENSECAG00000008270 | 2 retrocopies | |
| Equus caballus | ENSECAG00000015978 | 1 retrocopy | |
| Equus caballus | ENSECAG00000023552 | 1 retrocopy |
retro_ecab_761 ,
|
| Equus caballus | ENSECAG00000024852 | 1 retrocopy | |
| Homo sapiens | ENSG00000197416 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000016835 | 1 retrocopy | |
| Latimeria chalumnae | ENSLACG00000008511 | 3 retrocopies | |
| Microcebus murinus | ENSMICG00000005319 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000019337 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000002515 | 1 retrocopy | |
| Oryzias latipes | ENSORLG00000008282 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000018703 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000022654 | 1 retrocopy |