RetrogeneDB ID: | retro_ecab_464 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
| Coordinates: | 19:52761223..52761655(+) | ||
| Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSECAG00000006469 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 78.77 % |
| Parental protein coverage: | 100. % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected | 2 |
| Parental | MPKNKGKGGKN-RRRGKNENESE-KRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGIKRLCHIRGKLRKK |
| MPKNKGK.GK..R.RGKNEN.S..KREL..KEDGQEYAQV.KMLGNG.LE..CFDGI.RL.H.RGKLRKK | |
| Retrocopy | MPKNKGKRGKL<RCRGKNENSSK>KRELALKEDGQEYAQVMKMLGNG*LEVRCFDGINRLGHMRGKLRKK |
| Parental | VWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDD |
| .WINTSD.ILV.L.D.QDNKA.VILK.N.DEA.S.KAYGELPEHAK..ETDTFGPGDDD.IQFDDIG.D. | |
| Retrocopy | LWINTSDLILVAL*D*QDNKAGVILKPNQDEAISVKAYGELPEHAKFKETDTFGPGDDDGIQFDDIGNDE |
| Parental | EDIDDI |
| EDIDDI | |
| Retrocopy | EDIDDI |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 15 .41 RPM |
| SRP021940_cerebellum | 0 .00 RPM | 17 .35 RPM |
| SRP021940_embryo | 0 .03 RPM | 18 .92 RPM |
| SRP021940_placental_villous | 0 .05 RPM | 21 .70 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 11 .39 RPM |
| SRP021940_testis | 0 .06 RPM | 11 .13 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000005371 | 1 retrocopy | |
| Equus caballus | ENSECAG00000006469 | 2 retrocopies |
retro_ecab_464 , retro_ecab_634,
|
| Homo sapiens | ENSG00000173674 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000012977 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000027820 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000067194 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000008182 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000022504 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000005736 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000029864 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000026117 | 1 retrocopy |